PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV20203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family BES1
Protein Properties Length: 325aa    MW: 34604.6 Da    PI: 8.5842
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV20203.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822217.92.3e-67311581129
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 g+++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp   +e++g+s++++p+ss + s+ 
  KZV20203.1  31 GAGRRKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCKPC-PMEIGGTSNNITPCSSRNPSPP 128
                 6899************************************************************************.********************** PP

      DUF822 100 ssalaspvesysaspksssfpspssldsis 129
                 ss++asp++sy++sp+sssfpsps+ d + 
  KZV20203.1 129 SSYFASPIPSYQPSPSSSSFPSPSRHDGNA 158
                 *************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.4E-6233155IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MMWEAGGSTA SSSAAGGAGG SGGDGGGGGD GAGRRKPSWR ERENNRRRER RRRAIAAKIY  60
SGLRAQGNYN LPKHCDNNEV LKALCAEAGW IVEPDGTTYR KGCKPCPMEI GGTSNNITPC  120
SSRNPSPPSS YFASPIPSYQ PSPSSSSFPS PSRHDGNAPP HPFAFLLNSL PTALPSLRIS  180
NSAPVTPPLS SPTRNQNKLS LWMSAFNIPF FAASAPASPT RAQRFTPATI PECDEFSDTS  240
TIDSLKWMNF QAYANAVNVV PTSPTFNLVK PVAQQVPSMD AASDKGKGID FGLENMAVKP  300
WEGEMIHEVG MDDLELTLGS GNSRN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13352RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074507.11e-142PREDICTED: protein BRASSINAZOLE-RESISTANT 1 isoform X2
SwissprotQ8S3071e-109BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLK4BV771e-130K4BV77_SOLLC; Uncharacterized protein
STRINGSolyc04g079980.2.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.28e-87BES1 family protein